PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10100575 to PF05664 (DUF810)

VIMSS10100575 has 1117 amino acids

Query:       DUF810  [M=686]
Accession:   PF05664.11
Description: Plant family of unknown function (DUF810)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
     2e-204  667.0   4.3   2.6e-204  666.6   4.3    1.2  1  VIMSS10100575  


Domain annotation for each sequence (and alignments):
>> VIMSS10100575  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  666.6   4.3  2.6e-204  2.6e-204       1     685 [.     166     832 ..     166     833 .. 0.96

  Alignments for each domain:
  == domain 1  score: 666.6 bits;  conditional E-value: 2.6e-204
         DUF810   1 LsdddlretAYEillaacrssggkaltakskkkeesssaeaeaarsltskaaskvkkalglkksksspsrrsarrpltsaeimrvqmevseqsdar 96 
                    Lsdddlre+AYE+++a++ +s+ ++ +++   ++          r++ +k +s+++ +l++k + + +            +i  ++ e+s ++d++
  VIMSS10100575 166 LSDDDLREAAYELMIASMLLSSFLTNSVEAYPTH----------RRKIEK-SSRLMLSLKRKDKPHLQP-----------QISNTHSEISSKMDTC 239
                    89********************886666666665..........445555.899999999887755544...........7899999********* PP

         DUF810  97 lrktLlrilvgqvgrradtivlpLeLLrqlkksdFsdekeyeaWqkRqlkiLeagLllhpsvpldksntaakrlreiireaee..kaietsknsev 190
                    +r++L+++++ ++g+++d ++l+L+LL  ++ksdF++ek y++W++Rq+++Le++L+++ps++ +++ t+ ++++++ir+++e   +++ s + ev
  VIMSS10100575 240 IRRNLVQLATLRTGEQIDLPQLALGLLVGIFKSDFPNEKLYMKWKTRQANLLEEVLCFSPSLEKNERATM-RKCLATIRDSKEwdVVVSASLRIEV 334
                    **************************************************************99999888.9999*****99998999******** PP

         DUF810 191 lrslrnavvsLasr.skdgiesetchWadgypLNvrLYekLLeavFDvrdetqvleevdellellkktWsiLGinqklHnvcfaWvLfqqyvvtgq 285
                    l+s+r+++++L+s  +++gie+et++W++ y+LN+rLYekLL++vFD++de+qv+e++  +l ++k+ Ws+LGi+++lH ++++WvLfqq+v+tg 
  VIMSS10100575 335 LSSIRQVASKLSSLpGRCGIEEETYYWTAIYHLNIRLYEKLLFGVFDTLDEGQVIEDASSMLFHMKSIWSTLGITENLHSAIYGWVLFQQFVCTG- 429
                    ***********************************************************************************************. PP

         DUF810 286 vepdLleaalaqlkevak.dakktkeeaylk................llssvlasiqeWaekrLldYHesFekgniesmenvlslallaakilaed 364
                     ep+Ll +++++l++v++ ++ + ke++yl+                l++++l+s++ W++++L+dYH++F k + + +  ++ la +++   a+ 
  VIMSS10100575 430 -EPSLLGSTIQELQKVTSaESGNPKEDLYLShlvcsrqtigtdihlgLVKAILTSVSAWCDDKLQDYHLHFGK-KPRDFGMLVRLASTVGLPPADC 523
                    .*****************99999**************************************************.*******************996 PP

         DUF810 365 vsseerkakeeeaassesdsaservetYirsSikaafarvlekvdakskekeekeevLalLAketkelaekekevfspvLkrwhplaaavaavtLh 460
                    +++e  k ++       sd +s+++++Y+++Sik a+ar+++ + +ks  + e++++LalLA+e++ +a+ e + f pv+++w p++++++a++Lh
  VIMSS10100575 524 TRTELIKLDT------LSDDVSDKIQSYVQNSIKGACARAAHFAYVKS--HGERTHALALLANELTVIAKVEINEFVPVFSKWLPECMMISAMLLH 611
                    6555566554......567899*************************9..89******************************************** PP

         DUF810 461 klYgkeLkqflegvssltedvveVLqaAdkLekalvqlavedsadsedg.gkslvremkpYevesvianlvkkWvkerlkklkewveraleqEtWe 555
                    ++Yg++L +flegvssl+ dv++V++aA +L++ l+ql+    ++s+ + +k +++++k+Ye+e+++++++++W+ ++++++++w++ra+e+E+We
  VIMSS10100575 612 RFYGERLTPFLEGVSSLSGDVRKVVPAAYMLQEELTQLYN---CHSKSKlRKPYFHKLKNYEIEKAVKPVMLDWLISQHDHILQWTRRAFEIEEWE 704
                    ***************************************9...6666666********************************************** PP

         DUF810 556 PkskqeryaqSavellriieetvdeffelpvpmkeellqdLldgldkllqeYlskvasslgskeslvPslPaLTRckedsklkklwkkkavepcll 651
                    P+s q+r+a+S+ve++riieetv ++f+l++p+++++lq+Ll+ + ++l++Yl++v ++l++k+ l+Ps+P+LTR++e+++  +++k+k++e  ++
  VIMSS10100575 705 PLSVQQRHAASIVEIFRIIEETVSQLFGLHLPVDITHLQALLSLIYHSLDTYLQRVFDQLVDKKFLYPSAPPLTRFTENVM--PVMKRKSLEFSEP 798
                    *******************************************************************************99..9************ PP

         DUF810 652 dekrksklnslgtqkLcvrLNTLhyllsqlesle 685
                    d+k  +kl++l+++kLc+ LNTL y+++q+++ e
  VIMSS10100575 799 DNKIVKKLDELTIPKLCIILNTLCYIQKQISATE 832
                    ******************************9866 PP



Or compare VIMSS10100575 to CDD or PaperBLAST