PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001112362.1 to PF05768 (Glrx-like)

NP_001112362.1 has 106 amino acids

Query:       Glrx-like  [M=81]
Accession:   PF05768.18
Description: Glutaredoxin-like domain (DUF836)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.5e-10   26.2   0.0    5.8e-10   25.8   0.0    1.2  1  NP_001112362.1  


Domain annotation for each sequence (and alignments):
>> NP_001112362.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   25.8   0.0   5.8e-10   5.8e-10       1      42 [.      14      54 ..      14      79 .. 0.81

  Alignments for each domain:
  == domain 1  score: 25.8 bits;  conditional E-value: 5.8e-10
       Glrx-like  1 kliLyskpgCglCeeaeevLeelkledglelevidIdedeel 42
                    k++ + kp+C+ C +a+e L++l  ++g  le +dI++ ++ 
  NP_001112362.1 14 KVVVFIKPTCPYCRRAQEILSQLPIKQG-LLEFVDITATNHT 54
                    6899***********************9.79******54442 PP



Or compare NP_001112362.1 to CDD or PaperBLAST