Q25N99 has 106 amino acids
Query: Glrx-like [M=81]
Accession: PF05768.18
Description: Glutaredoxin-like domain (DUF836)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.4e-10 26.2 0.1 5.1e-10 26.0 0.1 1.2 1 Q25N99
Domain annotation for each sequence (and alignments):
>> Q25N99
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 26.0 0.1 5.1e-10 5.1e-10 1 42 [. 14 54 .. 14 90 .. 0.83
Alignments for each domain:
== domain 1 score: 26.0 bits; conditional E-value: 5.1e-10
Glrx-like 1 kliLyskpgCglCeeaeevLeelkledglelevidIdedeel 42
k++ + kp+C+ C +a+e L++l ++g le +dI++ ++
Q25N99 14 KVVVFIKPTCPYCRRAQEILSQLPIKQG-LLEFVDITATNHT 54
6899***********************9.79******54442 PP
Or compare Q25N99 to CDD or PaperBLAST