VIMSS368973 has 85 amino acids
Query: Glrx-like [M=81]
Accession: PF05768.18
Description: Glutaredoxin-like domain (DUF836)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.6e-27 81.0 0.1 3.9e-27 80.8 0.1 1.0 1 VIMSS368973
Domain annotation for each sequence (and alignments):
>> VIMSS368973
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 80.8 0.1 3.9e-27 3.9e-27 1 80 [. 9 84 .. 9 85 .] 0.96
Alignments for each domain:
== domain 1 score: 80.8 bits; conditional E-value: 3.9e-27
Glrx-like 1 kliLyskpgCglCeeaeevLeelkledglelevidIdedeeleekYqleipvlalvgikkslekeilswrldeeqlaaeL 80
kl+ y+++gC+lCee+ + L+ l++++++elevi+Id++e+l + Y++++pvl+ v+++ ke ++++ld++ + a+L
VIMSS368973 9 KLVVYGREGCHLCEEMIASLRVLQKKSWFELEVINIDGNEHLTRLYNDRVPVLFAVNED----KELCHYFLDSDVIGAYL 84
699******************************************************55....*************9988 PP
Or compare VIMSS368973 to CDD or PaperBLAST