K7EK95 has 60 amino acids
Query: DUF846 [M=139]
Accession: PF05832.15
Description: Eukaryotic protein of unknown function (DUF846)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.7e-15 41.6 1.1 7.1e-15 41.5 1.1 1.0 1 K7EK95
Domain annotation for each sequence (and alignments):
>> K7EK95
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 41.5 1.1 7.1e-15 7.1e-15 76 123 .. 1 48 [. 1 56 [. 0.94
Alignments for each domain:
== domain 1 score: 41.5 bits; conditional E-value: 7.1e-15
DUF846 76 esadekrkvnpidskvFWlllyvtpllwvvllilailklkflwlllvi 123
es++e+++v++++s++FWl l+++ +lwv++++ a+++++++wl+ v+
K7EK95 1 ESSQENKTVSEAESRIFWLGLIACSVLWVIFAFSALFSFTVKWLVTVF 48
678899**************************************9875 PP
Or compare K7EK95 to CDD or PaperBLAST