PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5607792 to PF05853 (BKACE)

VIMSS5607792 has 270 amino acids

Query:       BKACE  [M=274]
Accession:   PF05853.15
Description: beta-keto acid cleavage enzyme
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
   3.4e-106  340.6   0.1   3.8e-106  340.4   0.1    1.0  1  VIMSS5607792  


Domain annotation for each sequence (and alignments):
>> VIMSS5607792  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  340.4   0.1  3.8e-106  3.8e-106       3     274 .]       2     268 ..       1     268 [. 0.97

  Alignments for each domain:
  == domain 1  score: 340.4 bits;  conditional E-value: 3.8e-106
                   -EEEE-S-SSS-CCC-TTS--SHHHHHHHHHHHHHHTESEEEE-EE-TTTS-EE--HHHHHHHHHHHHHHHTTSEEEE-SSTTTTG-HHHHHTHHHH CS
         BKACE   3 iitvavtGavttkednpalPvtpeeiaeeaveaaeaGAaivHlHaRdpedgrpsldpelyrevlaairekepdviinlttggastmsaeerlavlea 99 
                   iit+a+ Ga + ke+npa+P+t+ee ++ea  a++aGA+i+HlH+R  +dg+p++d+++++ev++ai++ +pdvii+++tgga++m+ +erl+++e+
  VIMSS5607792   2 IITAAICGAEVLKEHNPAVPYTVEECVREAKSAYDAGASIIHLHVRY-DDGTPTQDKNRFKEVMEAIKAVCPDVIIQPSTGGAVGMTNDERLQPTEL 97 
                   9**********************************************.89*********************************************** PP

                   H--SEEEEE-S-EEEB-SGCEE---HHHHHHHHHHHHHTT-EEEEEESSHHHHHHHHHHHHTTSS-SSEEEEEEE--CTS--S-HHHHHHHHHHHHH CS
         BKACE 100 lkpemaslnlgslnfalkdlvfentpedieellrrmaeagvkpeievfdaghlrnvkrlieeGllkgpllvqlvlgvpggmpatpenLlflketadr 196
                   + pema+l++g+lnf+ +d+vf+nt+++i+ + ++m e+g+kpe+evfd ++++ + rl+++G+++ p+++++v+gv gg+  ++++++fl+e   +
  VIMSS5607792  98 F-PEMATLDCGTLNFG-GDEVFTNTENTIKYFGEKMIERGIKPELEVFDKSMIDMALRLHRKGYIQSPMHFDFVMGVNGGISGEMRDFVFLRE---S 189
                   5.*************6.89***********************************************************************655...5 PP

                   HTTC.EEEEEE-GGGHHHHHHHHHHTT-EEEESTTT-SEEETTEE-S-HHHHHHHHHHHHHHTT-EB--HHHHHHHCT. CS
         BKACE 197 lpeg.awsvagigraqlplataalalGghvRvGlEDnlylkkgelaksNaelVeravriaeelgrevatpaeaReilgL 274
                   +p++ +++vag+gr ++pla++a+  GghvRvG+EDn+y++kg+la+sN+elVe++vr+a+e+gre+atpaeaR+ilgL
  VIMSS5607792 190 IPADaTYTVAGVGRYEFPLAALAIIDGGHVRVGFEDNVYISKGVLARSNGELVEKVVRMAKEMGREIATPAEARRILGL 268
                   666857***********************************************************************97 PP



Or compare VIMSS5607792 to CDD or PaperBLAST