P0AEH5 has 101 amino acids
Query: DUF883 [M=53] Accession: PF05957.17 Description: DUF883 N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-13 37.3 4.4 1.8e-13 36.6 4.4 1.4 1 P0AEH5 Domain annotation for each sequence (and alignments): >> P0AEH5 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.6 4.4 1.8e-13 1.8e-13 3 52 .. 10 59 .. 8 60 .. 0.94 Alignments for each domain: == domain 1 score: 36.6 bits; conditional E-value: 1.8e-13 DUF883 3 liddlksLladleeLLksaadeageeadeLRerledrLkraRerlsdaqd 52 + ddl L ++lee+L+s++d a++++ eL++r+e++L++++ r s a d P0AEH5 10 IDDDLTLLSETLEEVLRSSGDPADQKYVELKARAEKALDDVKKRVSQASD 59 789****************************************9988776 PP
Or compare P0AEH5 to CDD or PaperBLAST