VIMSS217791 has 104 amino acids
Query: DUF883 [M=53] Accession: PF05957.17 Description: DUF883 N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-21 61.3 6.7 3.2e-21 61.3 6.7 2.0 2 VIMSS217791 Domain annotation for each sequence (and alignments): >> VIMSS217791 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.3 6.7 3.2e-21 3.2e-21 1 52 [. 11 62 .. 11 63 .. 0.96 2 ? 1.1 0.1 0.021 0.021 31 42 .. 63 74 .. 62 75 .. 0.80 Alignments for each domain: == domain 1 score: 61.3 bits; conditional E-value: 3.2e-21 DUF883 1 ekliddlksLladleeLLksaadeageeadeLRerledrLkraRerlsdaqd 52 e l++d+++L+ d+e LL+++a++ag++adeLRe++++rL++aRe+l +qd VIMSS217791 11 EILMADFQALVRDTEKLLADTANLAGDQADELREQIHERLAQARETLQLTQD 62 569********************************************99998 PP == domain 2 score: 1.1 bits; conditional E-value: 0.021 DUF883 31 eLRerledrLkr 42 +Rer +++L VIMSS217791 63 SVRERGQAALGS 74 689**9999976 PP
Or compare VIMSS217791 to CDD or PaperBLAST