VIMSS287466 has 101 amino acids
Query: DUF883 [M=53]
Accession: PF05957.17
Description: DUF883 N-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3e-12 32.6 3.4 5.1e-12 31.9 3.4 1.4 1 VIMSS287466
Domain annotation for each sequence (and alignments):
>> VIMSS287466
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 31.9 3.4 5.1e-12 5.1e-12 3 52 .. 10 59 .. 8 60 .. 0.94
Alignments for each domain:
== domain 1 score: 31.9 bits; conditional E-value: 5.1e-12
DUF883 3 liddlksLladleeLLksaadeageeadeLRerledrLkraRerlsdaqd 52
+ ddl L ++lee+L+s++d a++++ eL++ +e++L++++ r s a d
VIMSS287466 10 IDDDLTLLSETLEEVLRSSGDPADQKYVELKAHAEKALDDVKKRVSQASD 59
789****************************************9988776 PP
Or compare VIMSS287466 to CDD or PaperBLAST