VIMSS5796053 has 168 amino acids
Query: DUF892 [M=159] Accession: PF05974.16 Description: Domain of unknown function (DUF892) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-54 170.2 1.1 2.1e-54 170.0 1.1 1.0 1 VIMSS5796053 Domain annotation for each sequence (and alignments): >> VIMSS5796053 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 170.0 1.1 2.1e-54 2.1e-54 3 158 .. 4 156 .. 2 157 .. 0.98 Alignments for each domain: == domain 1 score: 170.0 bits; conditional E-value: 2.1e-54 DUF892 3 eelfideLrDayaaEkqalkalpkmakaaes.peLkaaleqHleeTeqqierleqvferlgeeasekkcdameglvaegqelleeaiedeevkdaal 98 e+++d+LrDa+a+Ekqa+++l++ma+++e+ p++ka++eqH++eT+ qi+ le+v+ r g + s k d m++++a gq++++++ +de+vk+ + VIMSS5796053 4 TEHYHDWLRDAHAMEKQAESMLESMASRIENyPDIKARIEQHISETKHQITMLEEVLDRNGISRSVLK-DSMSKMAAMGQSIGGMFPSDEIVKGSI- 98 69******************************************************************.***************************. PP DUF892 99 iaaaqavehyEiasYgtLialAeqlgeaeaaelLeqtldeEkatdekLtelaeelvnqea 158 +++++e++Eia+Y++L+a+A+++g++ ++e++l+eE +++++L ++++++++q++ VIMSS5796053 99 --SGYVFEQFEIACYTSLLAAAKKAGDTASIPTIEAILKEEMQMADWLIKHIPQTTEQFL 156 ..******************************************************9986 PP
Or compare VIMSS5796053 to CDD or PaperBLAST