PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS73192 to PF05974 (DUF892)

VIMSS73192 has 168 amino acids

Query:       DUF892  [M=159]
Accession:   PF05974.15
Description: Domain of unknown function (DUF892)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
      2e-58  183.1   9.3    2.2e-58  182.9   9.3    1.0  1  VIMSS73192  


Domain annotation for each sequence (and alignments):
>> VIMSS73192  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  182.9   9.3   2.2e-58   2.2e-58       2     158 ..       8     164 ..       7     165 .. 0.97

  Alignments for each domain:
  == domain 1  score: 182.9 bits;  conditional E-value: 2.2e-58
                 .HHHHHHHHHHHHHHHHHHHHHHHHHHHH-SSHHHHHHHHHHHHHHHHHHHHHHHHHHHTT-.------.-HHHHTTT-----------THHHHHHH.. CS
      DUF892   2 leelfideLrDlyaaEkqalkalpkmakaaespeLkaaleqHleeTqeqierLeqiferlge.sasekkcdamegliaegqelieefaedeslkdaali 99 
                 +e++fi+ L D+y+aEkq++kal+k+ ++a s++L+aa+++Hl+eT++qier++q++ + ++ + +++kc amegli+e++e+ie+  ++++++daali
  VIMSS73192   8 VEDIFIHLLSDTYSAEKQLTKALSKLSRSAYSDKLTAAFQSHLDETHGQIERIDQVVDSEDGlKLKRIKCAAMEGLIEEANEVIES-TDKNEVRDAALI 105
                 68*******************************************************98765389********************9.9*********** PP

                 .HHHHHHHHHHHHHHHHHHHHHCTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      DUF892 100 aaaqavehyEiasYgtLialAeqlgdkeaaelLeetldeekatdekLtelaeslvnqea 158
                 aaaq+vehyEiasYgtL++lAeqlg k+aa+lL+etl+eekatd kLt+la + vn++a
  VIMSS73192 106 AAAQKVEHYEIASYGTLVTLAEQLGYKKAAKLLKETLEEEKATDVKLTDLAFNNVNKKA 164
                 ********************************************************997 PP



Or compare VIMSS73192 to CDD or PaperBLAST