PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS93298 to PF05974 (DUF892)

VIMSS93298 has 168 amino acids

Query:       DUF892  [M=159]
Accession:   PF05974.15
Description: Domain of unknown function (DUF892)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    5.3e-53  165.5   0.3    5.8e-53  165.3   0.3    1.0  1  VIMSS93298  


Domain annotation for each sequence (and alignments):
>> VIMSS93298  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  165.3   0.3   5.8e-53   5.8e-53       4     157 ..       5     155 ..       2     157 .. 0.98

  Alignments for each domain:
  == domain 1  score: 165.3 bits;  conditional E-value: 5.8e-53
                 HHHHHHHHHHHHHHHHHHHHHHHHHHH-SS.HHHHHHHHHHHHHHHHHHHHHHHHHHHTT-------.-HHHHTTT-----------THHHHHHH...H CS
      DUF892   4 elfideLrDlyaaEkqalkalpkmakaaes.peLkaaleqHleeTqeqierLeqiferlgesasekkcdamegliaegqelieefaedeslkdaaliaa 101
                 e+++d+LrD++a+Ekqa+++l++ma+++++ peL+a++eqHl eT++qi +Le i+ r + s s +k d+m++++a gq +++ f++de++k+ +   +
  VIMSS93298   5 EHYHDWLRDAHAMEKQAESMLESMASRIDNyPELRARIEQHLSETKNQIVQLETILDRNDISRSVIK-DSMSKMAALGQSIGGIFPSDEIVKGSI---S 99 
                 89*****************************************************************.***************************...* PP

                 HHHHHHHHHHHHHHHHHHHHCTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      DUF892 102 aqavehyEiasYgtLialAeqlgdkeaaelLeetldeekatdekLtelaeslvnqe 157
                 ++ +e++Eia+Y++L+a+A+++gd+    ++e++l+eek+++++L+++++++++++
  VIMSS93298 100 GYVFEQFEIACYTSLLAAAKNAGDTASIPIIEAILNEEKQMADWLIQHIPQTTEKF 155
                 ***************************************************99986 PP



Or compare VIMSS93298 to CDD or PaperBLAST