WP_001079500.1 has 168 amino acids
Query: DUF892 [M=159] Accession: PF05974.15 Description: Domain of unknown function (DUF892) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-53 165.5 0.3 5.5e-53 165.4 0.3 1.0 1 WP_001079500.1 Domain annotation for each sequence (and alignments): >> WP_001079500.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 165.4 0.3 5.5e-53 5.5e-53 4 157 .. 5 155 .. 2 157 .. 0.98 Alignments for each domain: == domain 1 score: 165.4 bits; conditional E-value: 5.5e-53 HHHHHHHHHHHHHHHHHHHHHHHHHHH-SS.HHHHHHHHHHHHHHHHHHHHHHHHHHHTT-------.-HHHHTTT-----------THHHHHHH CS DUF892 4 elfideLrDlyaaEkqalkalpkmakaaes.peLkaaleqHleeTqeqierLeqiferlgesasekkcdamegliaegqelieefaedeslkdaa 97 e+++d+LrD++a+Ekqa+++l++ma+++++ peL+a++eqHl eT++qi +Le i+ r + s s +k d+m++++a gq +++ f++de++k+ + WP_001079500.1 5 EHYHDWLRDAHAMEKQAESMLESMASRIDNyPELRARIEQHLSETKNQIVQLETILDRNDISRSVIK-DSMSKMAALGQSIGGIFPSDEIVKGSI 98 89*****************************************************************.*************************** PP ...HHHHHHHHHHHHHHHHHHHHHCTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS DUF892 98 liaaaqavehyEiasYgtLialAeqlgdkeaaelLeetldeekatdekLtelaeslvnqe 157 +++ +e++Eia+Y++L+a+A+++gd+ ++e++l+eek+++++L+++++++++++ WP_001079500.1 99 ---SGYVFEQFEIACYTSLLAAAKNAGDTASIPTIEAILNEEKEMADWLIQHIPQTTEKF 155 ...****************************************************99986 PP
Or compare WP_001079500.1 to CDD or PaperBLAST