biolip::1u7mA has 53 amino acids
Query: DUF892 [M=159]
Accession: PF05974.16
Description: Domain of unknown function (DUF892)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.7e-10 25.2 1.3 8.8e-10 25.0 1.3 1.0 1 biolip::1u7mA
Domain annotation for each sequence (and alignments):
>> biolip::1u7mA
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 25.0 1.3 8.8e-10 8.8e-10 8 57 .. 2 51 .. 1 52 [. 0.96
Alignments for each domain:
== domain 1 score: 25.0 bits; conditional E-value: 8.8e-10
DUF892 8 deLrDayaaEkqalkalpkmakaaespeLkaaleqHleeTeqqierleqv 57
d Lr +y E+qa+k+ + ++a++pe k+ l++ le+ e++ie le +
biolip::1u7mA 2 DYLRELYKLEQQAMKLYREASEKARNPEKKSVLQKILEDEEKHIEWLETI 51
78*********************************************987 PP
Or compare biolip::1u7mA to CDD or PaperBLAST