PaperBLAST – Find papers about a protein or its homologs

 

Align A6T9R7 to PF06004 (DUF903)

A6T9R7 has 68 amino acids

Query:       DUF903  [M=49]
Accession:   PF06004.15
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.7e-27   81.5   1.5    1.9e-27   81.3   1.5    1.0  1  A6T9R7    


Domain annotation for each sequence (and alignments):
>> A6T9R7  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   81.3   1.5   1.9e-27   1.9e-27       1      49 []      18      66 ..      18      66 .. 0.98

  Alignments for each domain:
  == domain 1  score: 81.3 bits;  conditional E-value: 1.9e-27
            EEEEEETTS-EEEEES--EE-TTTSCEEEEBTTS-EEEEEGGGEEEEEE CS
  DUF903  1 pYvitTkDGrtivtdgkPklDkdtGmyeYeDeeGkevqInkddVkqike 49
            +Yv+tTk+G+tivt+gkP+lDk+tGm++Y De+G+++ In++dV+q  e
  A6T9R7 18 NYVMTTKSGQTIVTHGKPQLDKETGMTSYIDESGNKREINSSDVSQLVE 66
            7*********************************************877 PP



Or compare A6T9R7 to CDD or PaperBLAST