PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1236937 to PF06004 (DUF903)

VIMSS1236937 has 76 amino acids

Query:       DUF903  [M=49]
Accession:   PF06004.15
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.7e-28   84.7   4.4      2e-28   84.4   4.4    1.1  1  VIMSS1236937  


Domain annotation for each sequence (and alignments):
>> VIMSS1236937  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   84.4   4.4     2e-28     2e-28       1      49 []      25      73 ..      25      73 .. 0.98

  Alignments for each domain:
  == domain 1  score: 84.4 bits;  conditional E-value: 2e-28
                  EEEEEETTS-EEEEES--EE-TTTSCEEEEBTTS-EEEEEGGGEEEEEE CS
        DUF903  1 pYvitTkDGrtivtdgkPklDkdtGmyeYeDeeGkevqInkddVkqike 49
                  +Yv++T+DGrtiv+dgkP++D+dtGm++Y+D++G+++qIn+ dVk++ e
  VIMSS1236937 25 NYVMHTNDGRTIVSDGKPQTDNDTGMISYKDANGNKQQINRTDVKEMVE 73
                  7**********************************************97 PP



Or compare VIMSS1236937 to CDD or PaperBLAST