VIMSS148925 has 73 amino acids
Query: DUF903 [M=49] Accession: PF06004.15 Description: Bacterial protein of unknown function (DUF903) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.1e-28 82.3 4.2 1.1e-27 82.1 4.2 1.1 1 VIMSS148925 Domain annotation for each sequence (and alignments): >> VIMSS148925 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 82.1 4.2 1.1e-27 1.1e-27 1 48 [. 23 70 .. 23 71 .. 0.97 Alignments for each domain: == domain 1 score: 82.1 bits; conditional E-value: 1.1e-27 EEEEEETTS-EEEEES--EE-TTTSCEEEEBTTS-EEEEEGGGEEEEE CS DUF903 1 pYvitTkDGrtivtdgkPklDkdtGmyeYeDeeGkevqInkddVkqik 48 +Yv+tTk+G+tivt+gkP+lDk+tGm++Y+D+eG+++ In++dV+q + VIMSS148925 23 NYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQREINSNDVAQLI 70 7********************************************976 PP
Or compare VIMSS148925 to CDD or PaperBLAST