VIMSS149012 has 84 amino acids
Query: DUF903 [M=49] Accession: PF06004.15 Description: Bacterial protein of unknown function (DUF903) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-20 57.7 5.6 6.2e-20 57.3 5.6 1.2 1 VIMSS149012 Domain annotation for each sequence (and alignments): >> VIMSS149012 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 57.3 5.6 6.2e-20 6.2e-20 2 49 .] 30 77 .. 29 77 .. 0.97 Alignments for each domain: == domain 1 score: 57.3 bits; conditional E-value: 6.2e-20 EEEEETTS-EEEEES--EE-TTTSCEEEEBTTS-EEEEEGGGEEEEEE CS DUF903 2 YvitTkDGrtivtdgkPklDkdtGmyeYeDeeGkevqInkddVkqike 49 Y++tT++G++i t+gkP++D+ tGm++Y D +G +++++++++ q +e VIMSS149012 30 YTMTTRTGEIIETQGKPEVDTATGMTKYADVYGYHRVMKTSEIVQTTE 77 ********************************************9987 PP
Or compare VIMSS149012 to CDD or PaperBLAST