PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS150283 to PF06004 (DUF903)

VIMSS150283 has 75 amino acids

Query:       DUF903  [M=49]
Accession:   PF06004.16
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.7e-27   81.5   3.4    1.9e-27   81.3   3.4    1.1  1  VIMSS150283  


Domain annotation for each sequence (and alignments):
>> VIMSS150283  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   81.3   3.4   1.9e-27   1.9e-27       1      47 [.      24      70 ..      24      72 .. 0.98

  Alignments for each domain:
  == domain 1  score: 81.3 bits;  conditional E-value: 1.9e-27
       DUF903  1 pyvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqI 47
                 +yv++T+DG+ ivt+gkP++D+dtGm++Y+d++G+++qIn+ dVk++
  VIMSS150283 24 NYVMHTNDGRSIVTDGKPQTDNDTGMISYKDANGNKQQINRTDVKEM 70
                 7********************************************98 PP



Or compare VIMSS150283 to CDD or PaperBLAST