VIMSS3383600 has 76 amino acids
Query: DUF903 [M=49]
Accession: PF06004.16
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.1e-28 84.3 1.8 2.5e-28 84.1 1.8 1.1 1 VIMSS3383600
Domain annotation for each sequence (and alignments):
>> VIMSS3383600
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 84.1 1.8 2.5e-28 2.5e-28 1 47 [. 25 71 .. 25 73 .. 0.97
Alignments for each domain:
== domain 1 score: 84.1 bits; conditional E-value: 2.5e-28
DUF903 1 pyvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqI 47
+yv++T+DG+tivt+gkP++D+dtGm++Y+d+ G+++qIn++dVkq
VIMSS3383600 25 NYVMHTNDGRTIVTDGKPQTDNDTGMISYKDAWGNKQQINRSDVKQL 71
7********************************************97 PP
Or compare VIMSS3383600 to CDD or PaperBLAST