PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3626431 to PF06004 (DUF903)

VIMSS3626431 has 72 amino acids

Query:       DUF903  [M=49]
Accession:   PF06004.15
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    8.4e-29   85.7   3.8    9.8e-29   85.5   3.8    1.1  1  VIMSS3626431  


Domain annotation for each sequence (and alignments):
>> VIMSS3626431  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   85.5   3.8   9.8e-29   9.8e-29       1      49 []      23      71 ..      23      71 .. 0.99

  Alignments for each domain:
  == domain 1  score: 85.5 bits;  conditional E-value: 9.8e-29
                  EEEEEETTS-EEEEES--EE-TTTSCEEEEBTTS-EEEEEGGGEEEEEE CS
        DUF903  1 pYvitTkDGrtivtdgkPklDkdtGmyeYeDeeGkevqInkddVkqike 49
                  +Yv++TkDGr+i+tdgkP++D+dtG+++Y D++G+++qIn+ddV+qi+e
  VIMSS3626431 23 DYVMATKDGRMILTDGKPEVDDDTGLVSYNDQQGNKMQINRDDVSQIIE 71
                  6**********************************************98 PP



Or compare VIMSS3626431 to CDD or PaperBLAST