PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS365284 to PF06004 (DUF903)

VIMSS365284 has 72 amino acids

Query:       DUF903  [M=49]
Accession:   PF06004.15
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.5e-28   84.8   2.5    1.8e-28   84.6   2.5    1.1  1  VIMSS365284  


Domain annotation for each sequence (and alignments):
>> VIMSS365284  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   84.6   2.5   1.8e-28   1.8e-28       1      49 []      23      71 ..      23      71 .. 0.99

  Alignments for each domain:
  == domain 1  score: 84.6 bits;  conditional E-value: 1.8e-28
                 EEEEEETTS-EEEEES--EE-TTTSCEEEEBTTS-EEEEEGGGEEEEEE CS
       DUF903  1 pYvitTkDGrtivtdgkPklDkdtGmyeYeDeeGkevqInkddVkqike 49
                 +Yv++TkDGr+i+tdgkP++D+dtG+++Y+D++G+ +qIn+ddV+qi+e
  VIMSS365284 23 DYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQIIE 71
                 6**********************************************98 PP



Or compare VIMSS365284 to CDD or PaperBLAST