VIMSS365284 has 72 amino acids
Query: DUF903 [M=49] Accession: PF06004.15 Description: Bacterial protein of unknown function (DUF903) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-28 84.8 2.5 1.8e-28 84.6 2.5 1.1 1 VIMSS365284 Domain annotation for each sequence (and alignments): >> VIMSS365284 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 84.6 2.5 1.8e-28 1.8e-28 1 49 [] 23 71 .. 23 71 .. 0.99 Alignments for each domain: == domain 1 score: 84.6 bits; conditional E-value: 1.8e-28 EEEEEETTS-EEEEES--EE-TTTSCEEEEBTTS-EEEEEGGGEEEEEE CS DUF903 1 pYvitTkDGrtivtdgkPklDkdtGmyeYeDeeGkevqInkddVkqike 49 +Yv++TkDGr+i+tdgkP++D+dtG+++Y+D++G+ +qIn+ddV+qi+e VIMSS365284 23 DYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQIIE 71 6**********************************************98 PP
Or compare VIMSS365284 to CDD or PaperBLAST