VIMSS514064 has 73 amino acids
Query: DUF903 [M=49] Accession: PF06004.15 Description: Bacterial protein of unknown function (DUF903) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-24 70.1 3.3 7.6e-24 69.8 3.3 1.1 1 VIMSS514064 Domain annotation for each sequence (and alignments): >> VIMSS514064 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 69.8 3.3 7.6e-24 7.6e-24 1 49 [] 24 71 .. 24 71 .. 0.98 Alignments for each domain: == domain 1 score: 69.8 bits; conditional E-value: 7.6e-24 EEEEEETTS-EEEEES--EE-TTTSCEEEEBTTS-EEEEEGGGEEEEEE CS DUF903 1 pYvitTkDGrtivtdgkPklDkdtGmyeYeDeeGkevqInkddVkqike 49 p+v++ +DG+++vt ++Pk+++dtG+yeYe+ +G++vq+nkddVk+i+e VIMSS514064 24 PSVVQQRDGSQVVTPDEPKYNEDTGFYEYEK-DGHKVQMNKDDVKTIEE 71 69*****************************.***************98 PP
Or compare VIMSS514064 to CDD or PaperBLAST