PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS514064 to PF06004 (DUF903)

VIMSS514064 has 73 amino acids

Query:       DUF903  [M=49]
Accession:   PF06004.15
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.2e-24   70.1   3.3    7.6e-24   69.8   3.3    1.1  1  VIMSS514064  


Domain annotation for each sequence (and alignments):
>> VIMSS514064  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   69.8   3.3   7.6e-24   7.6e-24       1      49 []      24      71 ..      24      71 .. 0.98

  Alignments for each domain:
  == domain 1  score: 69.8 bits;  conditional E-value: 7.6e-24
                 EEEEEETTS-EEEEES--EE-TTTSCEEEEBTTS-EEEEEGGGEEEEEE CS
       DUF903  1 pYvitTkDGrtivtdgkPklDkdtGmyeYeDeeGkevqInkddVkqike 49
                 p+v++ +DG+++vt ++Pk+++dtG+yeYe+ +G++vq+nkddVk+i+e
  VIMSS514064 24 PSVVQQRDGSQVVTPDEPKYNEDTGFYEYEK-DGHKVQMNKDDVKTIEE 71
                 69*****************************.***************98 PP



Or compare VIMSS514064 to CDD or PaperBLAST