VIMSS514064 has 73 amino acids
Query: DUF903 [M=49] Accession: PF06004.16 Description: Bacterial protein of unknown function (DUF903) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-24 70.0 3.5 7.8e-24 69.7 3.5 1.1 1 VIMSS514064 Domain annotation for each sequence (and alignments): >> VIMSS514064 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 69.7 3.5 7.8e-24 7.8e-24 1 49 [] 24 71 .. 24 71 .. 0.98 Alignments for each domain: == domain 1 score: 69.7 bits; conditional E-value: 7.8e-24 DUF903 1 pyvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqIke 49 p+v++ +DG+++vt ++P++++dtG+yeYe+ +G++vq+nkddVk+I+e VIMSS514064 24 PSVVQQRDGSQVVTPDEPKYNEDTGFYEYEK-DGHKVQMNKDDVKTIEE 71 69*****************************.***************98 PP
Or compare VIMSS514064 to CDD or PaperBLAST