PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS59481 to PF06004 (DUF903)

VIMSS59481 has 73 amino acids

Query:       DUF903  [M=49]
Accession:   PF06004.15
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    3.2e-26   77.4   0.3    3.8e-26   77.2   0.3    1.1  1  VIMSS59481  


Domain annotation for each sequence (and alignments):
>> VIMSS59481  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   77.2   0.3   3.8e-26   3.8e-26       1      49 []      24      72 ..      24      72 .. 0.98

  Alignments for each domain:
  == domain 1  score: 77.2 bits;  conditional E-value: 3.8e-26
                EEEEEETTS-EEEEES--EE-TTTSCEEEEBTTS-EEEEEGGGEEEEEE CS
      DUF903  1 pYvitTkDGrtivtdgkPklDkdtGmyeYeDeeGkevqInkddVkqike 49
                p+vit++DGr+i+++++P +D+d+G+ye+e+++Gk+ ++nkd+V+++ke
  VIMSS59481 24 PTVITLNDGREIQAVDTPSYDEDSGFYEFEQLDGKRARVNKDQVRTVKE 72
                68*********************************************98 PP



Or compare VIMSS59481 to CDD or PaperBLAST