PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS61973 to PF06004 (DUF903)

VIMSS61973 has 70 amino acids

Query:       DUF903  [M=49]
Accession:   PF06004.15
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    3.9e-21   61.1   1.3    4.4e-21   60.9   1.3    1.0  1  VIMSS61973  


Domain annotation for each sequence (and alignments):
>> VIMSS61973  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   60.9   1.3   4.4e-21   4.4e-21       2      48 ..      22      68 ..      21      69 .. 0.97

  Alignments for each domain:
  == domain 1  score: 60.9 bits;  conditional E-value: 4.4e-21
                EEEEETTS-EEEEES--EE-TTTSCEEEEBTTS-EEEEEGGGEEEEE CS
      DUF903  2 YvitTkDGrtivtdgkPklDkdtGmyeYeDeeGkevqInkddVkqik 48
                 v+t++DG++++ +++ ++Dk++++ye+e+++G+++ I+kd+V++i+
  VIMSS61973 22 AVVTLQDGSEVLVKDQSDYDKYNDYYEFEQLNGDTILIKKDNVRTIR 68
                79********************************************8 PP



Or compare VIMSS61973 to CDD or PaperBLAST