WP_000750393.1 has 75 amino acids
Query: DUF903 [M=49] Accession: PF06004.15 Description: Bacterial protein of unknown function (DUF903) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-28 83.1 3.7 6.4e-28 82.8 3.7 1.1 1 WP_000750393.1 Domain annotation for each sequence (and alignments): >> WP_000750393.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 82.8 3.7 6.4e-28 6.4e-28 1 48 [. 24 71 .. 24 72 .. 0.98 Alignments for each domain: == domain 1 score: 82.8 bits; conditional E-value: 6.4e-28 EEEEEETTS-EEEEES--EE-TTTSCEEEEBTTS-EEEEEGGGEEEEE CS DUF903 1 pYvitTkDGrtivtdgkPklDkdtGmyeYeDeeGkevqInkddVkqik 48 +Yv++T+DGr ivtdgkP++D+dtGm++Y+D++G+++qIn+ dVk++ WP_000750393.1 24 NYVMHTNDGRSIVTDGKPQTDNDTGMISYKDANGNKQQINRTDVKEMV 71 7********************************************995 PP
Or compare WP_000750393.1 to CDD or PaperBLAST