PaperBLAST – Find papers about a protein or its homologs

 

Align WP_000750393.1 to PF06004 (DUF903)

WP_000750393.1 has 75 amino acids

Query:       DUF903  [M=49]
Accession:   PF06004.15
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.5e-28   83.1   3.7    6.4e-28   82.8   3.7    1.1  1  WP_000750393.1  


Domain annotation for each sequence (and alignments):
>> WP_000750393.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   82.8   3.7   6.4e-28   6.4e-28       1      48 [.      24      71 ..      24      72 .. 0.98

  Alignments for each domain:
  == domain 1  score: 82.8 bits;  conditional E-value: 6.4e-28
                    EEEEEETTS-EEEEES--EE-TTTSCEEEEBTTS-EEEEEGGGEEEEE CS
          DUF903  1 pYvitTkDGrtivtdgkPklDkdtGmyeYeDeeGkevqInkddVkqik 48
                    +Yv++T+DGr ivtdgkP++D+dtGm++Y+D++G+++qIn+ dVk++ 
  WP_000750393.1 24 NYVMHTNDGRSIVTDGKPQTDNDTGMISYKDANGNKQQINRTDVKEMV 71
                    7********************************************995 PP



Or compare WP_000750393.1 to CDD or PaperBLAST