WP_003089729.1 has 73 amino acids
Query: DUF903 [M=49] Accession: PF06004.16 Description: Bacterial protein of unknown function (DUF903) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-24 70.6 0.2 4.5e-24 70.5 0.2 1.0 1 WP_003089729.1 Domain annotation for each sequence (and alignments): >> WP_003089729.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 70.5 0.2 4.5e-24 4.5e-24 1 48 [. 24 71 .. 24 72 .. 0.97 Alignments for each domain: == domain 1 score: 70.5 bits; conditional E-value: 4.5e-24 DUF903 1 pyvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqIk 48 p+++t++DG++i+++++P++D ++G+ye e+++Gk++++nkd+V++Ik WP_003089729.1 24 PTIVTLNDGREIQAVDTPRYDRSSGFYELEQLDGKRTRVNKDQVRSIK 71 679********************************************8 PP
Or compare WP_003089729.1 to CDD or PaperBLAST