biolip::3fifF has 56 amino acids
Query: DUF903 [M=49] Accession: PF06004.15 Description: Bacterial protein of unknown function (DUF903) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-29 85.9 2.5 7.8e-29 85.8 2.5 1.0 1 biolip::3fifF Domain annotation for each sequence (and alignments): >> biolip::3fifF # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 85.8 2.5 7.8e-29 7.8e-29 1 49 [] 3 51 .. 3 51 .. 0.99 Alignments for each domain: == domain 1 score: 85.8 bits; conditional E-value: 7.8e-29 EEEEEETTS-EEEEES--EE-TTTSCEEEEBTTS-EEEEEGGGEEEEEE CS DUF903 1 pYvitTkDGrtivtdgkPklDkdtGmyeYeDeeGkevqInkddVkqike 49 +Yv++TkDGr+i+tdgkP++D+dtG+++Y+D++G+ +qIn+ddV+qi+e biolip::3fifF 3 DYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQIIE 51 6**********************************************98 PP
Or compare biolip::3fifF to CDD or PaperBLAST