VIMSS2159102 has 76 amino acids
Query: DUF905 [M=70]
Accession: PF06006.16
Description: Bacterial protein of unknown function (DUF905)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.2e-48 146.8 0.6 8.1e-48 146.6 0.6 1.0 1 VIMSS2159102
Domain annotation for each sequence (and alignments):
>> VIMSS2159102
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 146.6 0.6 8.1e-48 8.1e-48 2 70 .] 7 74 .. 6 74 .. 0.98
Alignments for each domain:
== domain 1 score: 146.6 bits; conditional E-value: 8.1e-48
DUF905 2 sLpdgtftreqaeavaaqyqnvaieDDqGthlrLvvrkadGemvWraWnfepgaeeglnryiesyGirk 70
+Lpd+tftreqae+vaaqy+nvaieDDqG+h+rLvvr+ +GemvWr+Wnfepg++++lnryi++yGirk
VIMSS2159102 7 VLPDDTFTREQAEVVAAQYTNVAIEDDQGAHFRLVVRQ-NGEMVWRTWNFEPGGTYWLNRYIADYGIRK 74
79************************************.*****************************8 PP
Or compare VIMSS2159102 to CDD or PaperBLAST