PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1077065 to PF06073 (DUF934)

VIMSS1077065 has 180 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.12
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    4.1e-48  148.0   0.0    5.4e-48  147.7   0.0    1.1  1  VIMSS1077065  


Domain annotation for each sequence (and alignments):
>> VIMSS1077065  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  147.7   0.0   5.4e-48   5.4e-48       1     107 []      61     167 ..      61     167 .. 0.99

  Alignments for each domain:
  == domain 1  score: 147.7 bits;  conditional E-value: 5.4e-48
        DUF934   1 gvllasdedveelaedlerlalialefpkFtDGRgySqarlLRerlgykgelravGdvlrDqlallkrcGfdafelredkdleaaekalkefsvaYq 97 
                   gv+la+d+++++la+d+ r+a+i +efp+F+DGRgyS+arlLRer+g+kgelra+GdvlrDql +++rcGfdaf++r+dk++++a++a+ efs+ Yq
  VIMSS1077065  61 GVWLAPDSEPADLAADFGRIAVIGVEFPRFADGRGYSIARLLRERHGWKGELRAIGDVLRDQLLYMSRCGFDAFAVRADKNIHDALNAFGEFSQRYQ 157
                   8************************************************************************************************ PP

        DUF934  98 aavdepeplf 107
                   +a+dep plf
  VIMSS1077065 158 SAFDEPAPLF 167
                   ********98 PP



Or compare VIMSS1077065 to CDD or PaperBLAST