VIMSS1077065 has 180 amino acids
Query: DUF934 [M=107]
Accession: PF06073.16
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6e-48 147.4 0.0 7.8e-48 147.1 0.0 1.1 1 VIMSS1077065
Domain annotation for each sequence (and alignments):
>> VIMSS1077065
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 147.1 0.0 7.8e-48 7.8e-48 1 107 [] 61 167 .. 61 167 .. 0.99
Alignments for each domain:
== domain 1 score: 147.1 bits; conditional E-value: 7.8e-48
DUF934 1 gvllasdedveelaadldrlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlellkrcGfdafelredkdaeaaekalerfsvaYq 97
gv+la+d+++++laad+ r+a+i +efp+F+DGRgyS+arlLRer+g+kgelrA+GdvlrDql ++ rcGfdaf++r+dk++++a +a+ +fs+ Yq
VIMSS1077065 61 GVWLAPDSEPADLAADFGRIAVIGVEFPRFADGRGYSIARLLRERHGWKGELRAIGDVLRDQLLYMSRCGFDAFAVRADKNIHDALNAFGEFSQRYQ 157
8************************************************************************************************ PP
DUF934 98 aavdeeqplf 107
+a de++plf
VIMSS1077065 158 SAFDEPAPLF 167
********98 PP
Or compare VIMSS1077065 to CDD or PaperBLAST