PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS58288 to PF06073 (DUF934)

VIMSS58288 has 165 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.12
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    2.2e-50  155.3   0.0    2.7e-50  155.0   0.0    1.1  1  VIMSS58288  


Domain annotation for each sequence (and alignments):
>> VIMSS58288  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  155.0   0.0   2.7e-50   2.7e-50       1     107 []      55     161 ..      55     161 .. 0.99

  Alignments for each domain:
  == domain 1  score: 155.0 bits;  conditional E-value: 2.7e-50
      DUF934   1 gvllasdedveelaedlerlalialefpkFtDGRgySqarlLRerlgykgelravGdvlrDqlallkrcGfdafelredkdleaaekalkefsvaYqaa 99 
                 gv+l++de++e++a dl+r+++ia++fp+FtDGRg+S+arlLRer+gykge+ra+GdvlrDql++++rcGfda+++r+d+++e+a+++l++fs++Yq++
  VIMSS58288  55 GVWLDADEEPESIAGDLDRFQVIAVNFPAFTDGRGFSSARLLRERYGYKGEIRAIGDVLRDQLFFMRRCGFDAYAIRADRSPEDALASLDDFSEVYQTS 153
                 8************************************************************************************************** PP

      DUF934 100 vdepeplf 107
                 v++p plf
  VIMSS58288 154 VEQPLPLF 161
                 *****997 PP



Or compare VIMSS58288 to CDD or PaperBLAST