VIMSS58288 has 165 amino acids
Query: DUF934 [M=107]
Accession: PF06073.15
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.5e-50 153.6 0.0 9.2e-50 153.3 0.0 1.1 1 VIMSS58288
Domain annotation for each sequence (and alignments):
>> VIMSS58288
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 153.3 0.0 9.2e-50 9.2e-50 1 107 [] 55 161 .. 55 161 .. 0.99
Alignments for each domain:
== domain 1 score: 153.3 bits; conditional E-value: 9.2e-50
DUF934 1 gvllasdedveelaadlerlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlallkrcGfdafelkedkdaeaaeaalkrfsvaYqaa 99
gv+l++de++e++a dl+r+++ia++fp+FtDGRg+S+arlLRer+gykge+rA+GdvlrDql++++rcGfda+++++d+++e+a a+l++fs++Yq++
VIMSS58288 55 GVWLDADEEPESIAGDLDRFQVIAVNFPAFTDGRGFSSARLLRERYGYKGEIRAIGDVLRDQLFFMRRCGFDAYAIRADRSPEDALASLDDFSEVYQTS 153
8************************************************************************************************** PP
DUF934 100 vdepqplf 107
v++p plf
VIMSS58288 154 VEQPLPLF 161
*****998 PP
Or compare VIMSS58288 to CDD or PaperBLAST