VIMSS58288 has 165 amino acids
Query: DUF934 [M=107] Accession: PF06073.15 Description: Bacterial protein of unknown function (DUF934) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-50 153.6 0.0 9.2e-50 153.3 0.0 1.1 1 VIMSS58288 Domain annotation for each sequence (and alignments): >> VIMSS58288 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 153.3 0.0 9.2e-50 9.2e-50 1 107 [] 55 161 .. 55 161 .. 0.99 Alignments for each domain: == domain 1 score: 153.3 bits; conditional E-value: 9.2e-50 DUF934 1 gvllasdedveelaadlerlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlallkrcGfdafelkedkdaeaaeaalkrfsvaYqaa 99 gv+l++de++e++a dl+r+++ia++fp+FtDGRg+S+arlLRer+gykge+rA+GdvlrDql++++rcGfda+++++d+++e+a a+l++fs++Yq++ VIMSS58288 55 GVWLDADEEPESIAGDLDRFQVIAVNFPAFTDGRGFSSARLLRERYGYKGEIRAIGDVLRDQLFFMRRCGFDAYAIRADRSPEDALASLDDFSEVYQTS 153 8************************************************************************************************** PP DUF934 100 vdepqplf 107 v++p plf VIMSS58288 154 VEQPLPLF 161 *****998 PP
Or compare VIMSS58288 to CDD or PaperBLAST