PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS58288 to PF06073 (DUF934)

VIMSS58288 has 165 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.15
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    7.5e-50  153.6   0.0    9.2e-50  153.3   0.0    1.1  1  VIMSS58288  


Domain annotation for each sequence (and alignments):
>> VIMSS58288  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  153.3   0.0   9.2e-50   9.2e-50       1     107 []      55     161 ..      55     161 .. 0.99

  Alignments for each domain:
  == domain 1  score: 153.3 bits;  conditional E-value: 9.2e-50
      DUF934   1 gvllasdedveelaadlerlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlallkrcGfdafelkedkdaeaaeaalkrfsvaYqaa 99 
                 gv+l++de++e++a dl+r+++ia++fp+FtDGRg+S+arlLRer+gykge+rA+GdvlrDql++++rcGfda+++++d+++e+a a+l++fs++Yq++
  VIMSS58288  55 GVWLDADEEPESIAGDLDRFQVIAVNFPAFTDGRGFSSARLLRERYGYKGEIRAIGDVLRDQLFFMRRCGFDAYAIRADRSPEDALASLDDFSEVYQTS 153
                 8************************************************************************************************** PP

      DUF934 100 vdepqplf 107
                 v++p plf
  VIMSS58288 154 VEQPLPLF 161
                 *****998 PP



Or compare VIMSS58288 to CDD or PaperBLAST