PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5848421 to PF06073 (DUF934)

VIMSS5848421 has 168 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.12
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    4.1e-42  128.7   0.1    5.5e-42  128.3   0.1    1.1  1  VIMSS5848421  


Domain annotation for each sequence (and alignments):
>> VIMSS5848421  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  128.3   0.1   5.5e-42   5.5e-42       1     103 [.      57     159 ..      57     162 .. 0.98

  Alignments for each domain:
  == domain 1  score: 128.3 bits;  conditional E-value: 5.5e-42
        DUF934   1 gvllasdedveelaedlerlalialefpkFtDGRgySqarlLRerlgykgelravGdvlrDqlallkrcGfdafelredkdleaaekalkefsvaYq 97 
                   gv++++d++ve la dl r+a++al+fpkF+DGR+y++arlLRer+gy+g +ravGdvl++q+ ++ rcGfdafe ++++++e ++ka ++f+++Yq
  VIMSS5848421  57 GVRIEPDQEVEVLAYDLPRIAVVALAFPKFRDGRAYTSARLLRERFGYQGHIRAVGDVLQEQAGFMVRCGFDAFEPADGATPEVLTKAANRFRHVYQ 153
                   89*********************************************************************************************** PP

        DUF934  98 aavdep 103
                   +a+d++
  VIMSS5848421 154 RAADDR 159
                   **9975 PP



Or compare VIMSS5848421 to CDD or PaperBLAST