VIMSS5848421 has 168 amino acids
Query: DUF934 [M=107]
Accession: PF06073.12
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.1e-42 128.7 0.1 5.5e-42 128.3 0.1 1.1 1 VIMSS5848421
Domain annotation for each sequence (and alignments):
>> VIMSS5848421
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 128.3 0.1 5.5e-42 5.5e-42 1 103 [. 57 159 .. 57 162 .. 0.98
Alignments for each domain:
== domain 1 score: 128.3 bits; conditional E-value: 5.5e-42
DUF934 1 gvllasdedveelaedlerlalialefpkFtDGRgySqarlLRerlgykgelravGdvlrDqlallkrcGfdafelredkdleaaekalkefsvaYq 97
gv++++d++ve la dl r+a++al+fpkF+DGR+y++arlLRer+gy+g +ravGdvl++q+ ++ rcGfdafe ++++++e ++ka ++f+++Yq
VIMSS5848421 57 GVRIEPDQEVEVLAYDLPRIAVVALAFPKFRDGRAYTSARLLRERFGYQGHIRAVGDVLQEQAGFMVRCGFDAFEPADGATPEVLTKAANRFRHVYQ 153
89*********************************************************************************************** PP
DUF934 98 aavdep 103
+a+d++
VIMSS5848421 154 RAADDR 159
**9975 PP
Or compare VIMSS5848421 to CDD or PaperBLAST