PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS590298 to PF06073 (DUF934)

VIMSS590298 has 172 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.12
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      1e-35  108.1   0.2    1.5e-35  107.7   0.2    1.2  1  VIMSS590298  


Domain annotation for each sequence (and alignments):
>> VIMSS590298  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  107.7   0.2   1.5e-35   1.5e-35       3     105 ..      65     166 ..      63     168 .. 0.94

  Alignments for each domain:
  == domain 1  score: 107.7 bits;  conditional E-value: 1.5e-35
       DUF934   3 llasdedveelaedlerlalialefpkFtDGRgySqarlLRerlgykgelravGdvlrDqlallkrcGfdafelredkdleaaekalkefsvaYqaav 100
                   ++ ++++e+ +  l++l+ i +ef+ F+DGRgyS a+lLR r gy+gelravGd+++D l++lkr+Gfd+f+++e+kd+++a++ l++f++ Yqa++
  VIMSS590298  65 YITVNDSPETHQFPLDQLDAIFIEFAGFNDGRGYSFAALLR-RQGYQGELRAVGDIFKDVLNYLKRSGFDTFVIKEGKDIQEAAAGLNDFRQPYQAST 161
                  5777899999999****************************.66*****************************************************9 PP

       DUF934 101 depep 105
                  + p++
  VIMSS590298 162 AVPQA 166
                  98775 PP



Or compare VIMSS590298 to CDD or PaperBLAST