PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5927579 to PF06073 (DUF934)

VIMSS5927579 has 145 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.15
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.6e-38  117.2   0.1    2.1e-38  116.8   0.1    1.1  1  VIMSS5927579  


Domain annotation for each sequence (and alignments):
>> VIMSS5927579  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  116.8   0.1   2.1e-38   2.1e-38       3     103 ..      33     133 ..      31     136 .. 0.96

  Alignments for each domain:
  == domain 1  score: 116.8 bits;  conditional E-value: 2.1e-38
        DUF934   3 llasdedveelaadlerlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlallkrcGfdafelkedkdaeaaeaalkrfsvaYqaa 99 
                   ++ +de++  laa+++++++i+l+fp+FtDGR+ySqa+lLR+r+g++g+lrA+Gdvl+Dql l++r+Gf++++l + +d++ a+++l+rf+ +Yq++
  VIMSS5927579  33 TIGNDEELPPLAARIAHATRIDLQFPSFTDGRAYSQAYLLRKRYGFAGDLRATGDVLVDQLLLMERTGFSSAVLGDAADLAVARRQLDRFPGFYQRD 129
                   57899*******************************************************************************************9 PP

        DUF934 100 vdep 103
                   +++ 
  VIMSS5927579 130 ARTV 133
                   9865 PP



Or compare VIMSS5927579 to CDD or PaperBLAST