VIMSS5927579 has 145 amino acids
Query: DUF934 [M=107] Accession: PF06073.12 Description: Bacterial protein of unknown function (DUF934) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-38 117.4 0.0 1.9e-38 117.0 0.0 1.1 1 VIMSS5927579 Domain annotation for each sequence (and alignments): >> VIMSS5927579 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 117.0 0.0 1.9e-38 1.9e-38 3 103 .. 33 133 .. 31 136 .. 0.96 Alignments for each domain: == domain 1 score: 117.0 bits; conditional E-value: 1.9e-38 DUF934 3 llasdedveelaedlerlalialefpkFtDGRgySqarlLRerlgykgelravGdvlrDqlallkrcGfdafelredkdleaaekalkefsvaYqaa 99 ++ +de++ la+++++++ i+l+fp+FtDGR+ySqa+lLR+r+g++g+lra+Gdvl+Dql l++r+Gf++++l + +dl+ a+++l++f+ +Yq++ VIMSS5927579 33 TIGNDEELPPLAARIAHATRIDLQFPSFTDGRAYSQAYLLRKRYGFAGDLRATGDVLVDQLLLMERTGFSSAVLGDAADLAVARRQLDRFPGFYQRD 129 67899*******************************************************************************************9 PP DUF934 100 vdep 103 +++ VIMSS5927579 130 ARTV 133 9875 PP
Or compare VIMSS5927579 to CDD or PaperBLAST