VIMSS5927579 has 145 amino acids
Query: DUF934 [M=107]
Accession: PF06073.12
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.4e-38 117.4 0.0 1.9e-38 117.0 0.0 1.1 1 VIMSS5927579
Domain annotation for each sequence (and alignments):
>> VIMSS5927579
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 117.0 0.0 1.9e-38 1.9e-38 3 103 .. 33 133 .. 31 136 .. 0.96
Alignments for each domain:
== domain 1 score: 117.0 bits; conditional E-value: 1.9e-38
DUF934 3 llasdedveelaedlerlalialefpkFtDGRgySqarlLRerlgykgelravGdvlrDqlallkrcGfdafelredkdleaaekalkefsvaYqaa 99
++ +de++ la+++++++ i+l+fp+FtDGR+ySqa+lLR+r+g++g+lra+Gdvl+Dql l++r+Gf++++l + +dl+ a+++l++f+ +Yq++
VIMSS5927579 33 TIGNDEELPPLAARIAHATRIDLQFPSFTDGRAYSQAYLLRKRYGFAGDLRATGDVLVDQLLLMERTGFSSAVLGDAADLAVARRQLDRFPGFYQRD 129
67899*******************************************************************************************9 PP
DUF934 100 vdep 103
+++
VIMSS5927579 130 ARTV 133
9875 PP
Or compare VIMSS5927579 to CDD or PaperBLAST