PaperBLAST – Find papers about a protein or its homologs

 

Align WP_000935247.1 to PF06073 (DUF934)

WP_000935247.1 has 161 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.12
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.6e-35  106.4   0.1    4.7e-35  106.1   0.1    1.2  1  WP_000935247.1  


Domain annotation for each sequence (and alignments):
>> WP_000935247.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  106.1   0.1   4.7e-35   4.7e-35       4     105 ..      55     155 ..      52     157 .. 0.94

  Alignments for each domain:
  == domain 1  score: 106.1 bits;  conditional E-value: 4.7e-35
          DUF934   4 lasdedveelaedlerlalialefpkFtDGRgySqarlLRerlgykgelravGdvlrDqlallkrcGfdafelredkdleaaekalkefsvaYqa 98 
                     ++ ++++e+ +  l++l+ i +ef+ F DGRgyS a+lLR r g++gelra+Gdv++D l++lkr+Gfd+f+++e+kd+++a++ l++f++ Yqa
  WP_000935247.1  55 VTVNDSPEDHTFPLSELDAIFIEFAGFGDGRGYSFAALLR-RQGFQGELRATGDVFKDVLNYLKRSGFDSFVIKEGKDVQEAAAGLQDFTHPYQA 148
                     6678899999999***************************.66**************************************************** PP

          DUF934  99 avdepep 105
                     +++ p++
  WP_000935247.1 149 STAVPKA 155
                     9987765 PP



Or compare WP_000935247.1 to CDD or PaperBLAST