PaperBLAST – Find papers about a protein or its homologs

 

Align WP_003460364.1 to PF06073 (DUF934)

WP_003460364.1 has 159 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.12
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      3e-28   84.1   0.0    4.3e-28   83.7   0.0    1.2  1  WP_003460364.1  


Domain annotation for each sequence (and alignments):
>> WP_003460364.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   83.7   0.0   4.3e-28   4.3e-28       1      91 [.      50     140 ..      50     149 .. 0.93

  Alignments for each domain:
  == domain 1  score: 83.7 bits;  conditional E-value: 4.3e-28
          DUF934   1 gvllasdedveelaedlerlalialefpkFtDGRgySqarlLRerlgykgelravGdvlrDqlallkrcGfdafelredkdleaaekalke 91 
                     gv+++ d+d+++l + l+r +++ +efpk +DGRg+++ar+LRer++y+g++ra+G +l Dq+++l +cG +++  ++   l ++++a  +
  WP_003460364.1  50 GVWVTGDQDPADLLALLNRTRVVVIEFPKSRDGRGFTLARVLRERHRYDGDIRAAGPLLPDQFSMLIQCGYTSVLAEAAIPLVRWKEAAMA 140
                     8*************************************************************************99998888888776655 PP



Or compare WP_003460364.1 to CDD or PaperBLAST