PaperBLAST – Find papers about a protein or its homologs

 

Align WP_012074312.1 to PF06073 (DUF934)

WP_012074312.1 has 162 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.12
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.8e-42  129.9   0.0    2.2e-42  129.6   0.0    1.1  1  WP_012074312.1  


Domain annotation for each sequence (and alignments):
>> WP_012074312.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  129.6   0.0   2.2e-42   2.2e-42       3     107 .]      55     159 ..      53     159 .. 0.99

  Alignments for each domain:
  == domain 1  score: 129.6 bits;  conditional E-value: 2.2e-42
          DUF934   3 llasdedveelaedlerlalialefpkFtDGRgySqarlLRerlgykgelravGdvlrDqlallkrcGfdafelredkdleaaekalkefsvaYq 97 
                     +la+d++ve l +++++l+lia++fp+F+DGRgyS+a+lLR rlg++gelravGdvlrDql+++++cGfdaf++redk++e+a+k l+ +sv Y 
  WP_012074312.1  55 WLAPDDEVEVLLPYFAELPLIAVDFPSFRDGRGYSLAYLLRVRLGWSGELRAVGDVLRDQLSHMRQCGFDAFAVREDKNVEDALKGLAGLSVLYG 149
                     89********************************************************************************************* PP

          DUF934  98 aavdepeplf 107
                     +++ ep+plf
  WP_012074312.1 150 RSAIEPRPLF 159
                     ********98 PP



Or compare WP_012074312.1 to CDD or PaperBLAST