WP_012074312.1 has 162 amino acids
Query: DUF934 [M=107] Accession: PF06073.12 Description: Bacterial protein of unknown function (DUF934) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-42 129.9 0.0 2.2e-42 129.6 0.0 1.1 1 WP_012074312.1 Domain annotation for each sequence (and alignments): >> WP_012074312.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 129.6 0.0 2.2e-42 2.2e-42 3 107 .] 55 159 .. 53 159 .. 0.99 Alignments for each domain: == domain 1 score: 129.6 bits; conditional E-value: 2.2e-42 DUF934 3 llasdedveelaedlerlalialefpkFtDGRgySqarlLRerlgykgelravGdvlrDqlallkrcGfdafelredkdleaaekalkefsvaYq 97 +la+d++ve l +++++l+lia++fp+F+DGRgyS+a+lLR rlg++gelravGdvlrDql+++++cGfdaf++redk++e+a+k l+ +sv Y WP_012074312.1 55 WLAPDDEVEVLLPYFAELPLIAVDFPSFRDGRGYSLAYLLRVRLGWSGELRAVGDVLRDQLSHMRQCGFDAFAVREDKNVEDALKGLAGLSVLYG 149 89********************************************************************************************* PP DUF934 98 aavdepeplf 107 +++ ep+plf WP_012074312.1 150 RSAIEPRPLF 159 ********98 PP
Or compare WP_012074312.1 to CDD or PaperBLAST