PaperBLAST – Find papers about a protein or its homologs

 

Align WP_015276909.1 to PF06073 (DUF934)

WP_015276909.1 has 166 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.12
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    9.2e-51  156.6   0.2    1.2e-50  156.2   0.2    1.1  1  WP_015276909.1  


Domain annotation for each sequence (and alignments):
>> WP_015276909.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  156.2   0.2   1.2e-50   1.2e-50       1     107 []      55     161 ..      55     161 .. 0.99

  Alignments for each domain:
  == domain 1  score: 156.2 bits;  conditional E-value: 1.2e-50
          DUF934   1 gvllasdedveelaedlerlalialefpkFtDGRgySqarlLRerlgykgelravGdvlrDqlallkrcGfdafelredkdleaaekalkefsva 95 
                     gv+l+++e+vee+a+dl+++++ial+fp+FtDGR+yS+arlLRer+gykge+ra+GdvlrDql++++rcGfdaf++r+d+d+ +a++ lk+fsv+
  WP_015276909.1  55 GVWLDAHEQVEEIADDLQHFQVIALNFPSFTDGRHYSSARLLRERYGYKGEIRAIGDVLRDQLFYMRRCGFDAFAIRADRDPVDALEGLKDFSVT 149
                     8********************************************************************************************** PP

          DUF934  96 Yqaavdepeplf 107
                     Yqaa+d+++plf
  WP_015276909.1 150 YQAAADDERPLF 161
                     **********98 PP



Or compare WP_015276909.1 to CDD or PaperBLAST