PaperBLAST – Find papers about a protein or its homologs

 

Align WP_054614933.1 to PF06073 (DUF934)

WP_054614933.1 has 159 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.12
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    9.6e-44  134.0   0.0    1.2e-43  133.7   0.0    1.1  1  WP_054614933.1  


Domain annotation for each sequence (and alignments):
>> WP_054614933.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  133.7   0.0   1.2e-43   1.2e-43       1     107 []      50     156 ..      50     156 .. 0.99

  Alignments for each domain:
  == domain 1  score: 133.7 bits;  conditional E-value: 1.2e-43
          DUF934   1 gvllasdedveelaedlerlalialefpkFtDGRgySqarlLRerlgykgelravGdvlrDqlallkrcGfdafelredkdleaaekalkefsva 95 
                     +v+l +d++ve+l++ ++ l+lial+fp+F+DGRgySqa+lLR+rlg+kgelra+GdvlrDql+++++cGfd+f++re+k++e+a+k l+ +sv 
  WP_054614933.1  50 AVWLGPDDEVESLKSCFNLLPLIALDFPSFRDGRGYSQAYLLRTRLGWKGELRAIGDVLRDQLSHMRQCGFDSFAVREEKSAEDALKGLAGMSVL 144
                     69********************************************************************************************* PP

          DUF934  96 Yqaavdepeplf 107
                     Y ++v ep+plf
  WP_054614933.1 145 YGRSVIEPRPLF 156
                     **********98 PP



Or compare WP_054614933.1 to CDD or PaperBLAST