PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::BFirm:BPHYT_RS04730 to PF06073 (DUF934)

reanno::BFirm:BPHYT_RS04730 has 179 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.12
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                    -----------
      8e-46  140.7   0.1      1e-45  140.4   0.1    1.1  1  reanno::BFirm:BPHYT_RS04730  


Domain annotation for each sequence (and alignments):
>> reanno::BFirm:BPHYT_RS04730  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  140.4   0.1     1e-45     1e-45       1     106 [.      61     165 ..      61     166 .. 0.97

  Alignments for each domain:
  == domain 1  score: 140.4 bits;  conditional E-value: 1e-45
                       DUF934   1 gvllasdedveelaedlerlalialefpkFtDGRgySqarlLRerlgykgelravGdvlrDqlallkrcGfdafelredkdl 82 
                                  gv+la+d++++++++d++++ali ++fp F+DGRgyS++rlLRer+gykgelra+GdvlrDqla++ rcGfda++lr+dkd 
  reanno::BFirm:BPHYT_RS04730  61 GVWLAPDSEPADIVADFDKIALIGVDFPVFRDGRGYSIGRLLRERYGYKGELRAIGDVLRDQLAFMFRCGFDAYALRADKDF 142
                                  8********************************************************************************* PP

                       DUF934  83 eaaekalkefsvaYqaavdepepl 106
                                  ++a+ka++efs +Yq+av++ +pl
  reanno::BFirm:BPHYT_RS04730 143 DDALKAFDEFSFNYQGAVNS-SPL 165
                                  *****************985.466 PP



Or compare reanno::BFirm:BPHYT_RS04730 to CDD or PaperBLAST