reanno::BFirm:BPHYT_RS04730 has 179 amino acids
Query: DUF934 [M=107] Accession: PF06073.15 Description: Bacterial protein of unknown function (DUF934) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-45 140.0 0.1 1.6e-45 139.7 0.1 1.1 1 reanno::BFirm:BPHYT_RS04730 Domain annotation for each sequence (and alignments): >> reanno::BFirm:BPHYT_RS04730 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 139.7 0.1 1.6e-45 1.6e-45 1 106 [. 61 165 .. 61 166 .. 0.97 Alignments for each domain: == domain 1 score: 139.7 bits; conditional E-value: 1.6e-45 DUF934 1 gvllasdedveelaadlerlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlallkrcGfdafelkedkda 82 gv+la+d+++++++ad++++ali ++fp F+DGRgyS++rlLRer+gykgelrA+GdvlrDqla++ rcGfda++l++dkd reanno::BFirm:BPHYT_RS04730 61 GVWLAPDSEPADIVADFDKIALIGVDFPVFRDGRGYSIGRLLRERYGYKGELRAIGDVLRDQLAFMFRCGFDAYALRADKDF 142 8********************************************************************************* PP DUF934 83 eaaeaalkrfsvaYqaavdepqpl 106 ++a +a+++fs +Yq+av++ +pl reanno::BFirm:BPHYT_RS04730 143 DDALKAFDEFSFNYQGAVNS-SPL 165 *****************986.466 PP
Or compare reanno::BFirm:BPHYT_RS04730 to CDD or PaperBLAST