PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::Marino:GFF1839 to PF06073 (DUF934)

reanno::Marino:GFF1839 has 168 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.12
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------               -----------
    8.3e-45  137.4   0.0      1e-44  137.1   0.0    1.1  1  reanno::Marino:GFF1839  


Domain annotation for each sequence (and alignments):
>> reanno::Marino:GFF1839  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  137.1   0.0     1e-44     1e-44       1     107 []      57     163 ..      57     163 .. 0.99

  Alignments for each domain:
  == domain 1  score: 137.1 bits;  conditional E-value: 1e-44
                  DUF934   1 gvllasdedveelaedlerlalialefpkFtDGRgySqarlLRerlgykgelravGdvlrDqlallkrcGfdafelredkdleaaek 87 
                             gv+++s++++e l  ++++l++ia++fpkF+DGRgyS++rlLRer+gyk+elra+Gdvl Dql+++krcGfda++lr+dkd+++a++
  reanno::Marino:GFF1839  57 GVWFDSHDEPEILDGRVNELPVIAVNFPKFSDGRGYSIGRLLRERFGYKNELRAIGDVLLDQLQFMKRCGFDAYVLRADKDINKAAR 143
                             8************************************************************************************** PP

                  DUF934  88 alkefsvaYqaavdepeplf 107
                              l+ fs+ Yqaa+d++ plf
  reanno::Marino:GFF1839 144 CLNFFSQGYQAATDTEIPLF 163
                             ****************9987 PP



Or compare reanno::Marino:GFF1839 to CDD or PaperBLAST