reanno::Marino:GFF1839 has 168 amino acids
Query: DUF934 [M=107]
Accession: PF06073.16
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3e-44 135.5 0.0 3.7e-44 135.2 0.0 1.1 1 reanno::Marino:GFF1839
Domain annotation for each sequence (and alignments):
>> reanno::Marino:GFF1839
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 135.2 0.0 3.7e-44 3.7e-44 1 107 [] 57 163 .. 57 163 .. 0.99
Alignments for each domain:
== domain 1 score: 135.2 bits; conditional E-value: 3.7e-44
DUF934 1 gvllasdedveelaadldrlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlellkrcGfdafelredkdaeaaek 87
gv+++s++++e l ++++l++ia++fpkF DGRgyS++rlLRer+gyk+elrA+Gdvl Dql+++krcGfda++lr+dkd+++a++
reanno::Marino:GFF1839 57 GVWFDSHDEPEILDGRVNELPVIAVNFPKFSDGRGYSIGRLLRERFGYKNELRAIGDVLLDQLQFMKRCGFDAYVLRADKDINKAAR 143
8************************************************************************************** PP
DUF934 88 alerfsvaYqaavdeeqplf 107
l+ fs+ Yqaa+d+e plf
reanno::Marino:GFF1839 144 CLNFFSQGYQAATDTEIPLF 163
***************99987 PP
Or compare reanno::Marino:GFF1839 to CDD or PaperBLAST