PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::acidovorax_3H11:Ac3H11_576 to PF06073 (DUF934)

reanno::acidovorax_3H11:Ac3H11_576 has 128 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.12
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
    2.5e-40  123.0   0.2      3e-40  122.8   0.2    1.0  1  reanno::acidovorax_3H11:Ac3H11_576  


Domain annotation for each sequence (and alignments):
>> reanno::acidovorax_3H11:Ac3H11_576  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  122.8   0.2     3e-40     3e-40       3     107 .]      21     123 ..      19     123 .. 0.93

  Alignments for each domain:
  == domain 1  score: 122.8 bits;  conditional E-value: 3e-40
                              DUF934   3 llasdedveelaedlerlalialefpkFtDGRgySqarlLRerlgykgelravGdvlrDqlallkrcGfdafelr 77 
                                         +la+d+  ++la  l+ ++ ++l+fp+FtDGR++Sqa lLR+r g++g++ra+Gdvl+Dql +++r+Gf++++lr
  reanno::acidovorax_3H11:Ac3H11_576  21 ALANDA--DALALPLDGVERVDLHFPSFTDGRAFSQAFLLRRRRGFAGDIRATGDVLIDQLVQMQRTGFSSAVLR 93 
                                         555555..555666************************************************************* PP

                              DUF934  78 edkdleaaekalkefsvaYqaavdepeplf 107
                                         e+ d+++a++++++f+ +Yq+++ +p+plf
  reanno::acidovorax_3H11:Ac3H11_576  94 EGVDPADAQRQFERFPGFYQGDAVNPQPLF 123
                                         ****************************98 PP



Or compare reanno::acidovorax_3H11:Ac3H11_576 to CDD or PaperBLAST