reanno::acidovorax_3H11:Ac3H11_576 has 128 amino acids
Query: DUF934 [M=107] Accession: PF06073.16 Description: Bacterial protein of unknown function (DUF934) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-40 121.6 0.2 7.6e-40 121.4 0.2 1.0 1 reanno::acidovorax_3H11:Ac3H11_576 Domain annotation for each sequence (and alignments): >> reanno::acidovorax_3H11:Ac3H11_576 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 121.4 0.2 7.6e-40 7.6e-40 2 107 .] 20 123 .. 19 123 .. 0.93 Alignments for each domain: == domain 1 score: 121.4 bits; conditional E-value: 7.6e-40 DUF934 2 vllasdedveelaadldrlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlellkrcGfdafel 76 v+la+d+d +la ld ++ ++l+fp+FtDGR++Sqa lLR+r g++g++rA+Gdvl+Dql +++r+Gf++++l reanno::acidovorax_3H11:Ac3H11_576 20 VALANDAD--ALALPLDGVERVDLHFPSFTDGRAFSQAFLLRRRRGFAGDIRATGDVLIDQLVQMQRTGFSSAVL 92 45555555..55666************************************************************ PP DUF934 77 redkdaeaaekalerfsvaYqaavdeeqplf 107 re+ d+++a++++erf +Yq+++ ++qplf reanno::acidovorax_3H11:Ac3H11_576 93 REGVDPADAQRQFERFPGFYQGDAVNPQPLF 123 *****************************98 PP
Or compare reanno::acidovorax_3H11:Ac3H11_576 to CDD or PaperBLAST