PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::pseudo13_GW456_L13:PfGW456L13_2842 to PF06073 (DUF934)

reanno::pseudo13_GW456_L13:PfGW456L13_2842 has 164 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.12
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                   -----------
    9.6e-50  153.3   0.1    1.2e-49  153.0   0.1    1.1  1  reanno::pseudo13_GW456_L13:PfGW456L13_2842  


Domain annotation for each sequence (and alignments):
>> reanno::pseudo13_GW456_L13:PfGW456L13_2842  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  153.0   0.1   1.2e-49   1.2e-49       1     107 []      55     161 ..      55     161 .. 0.99

  Alignments for each domain:
  == domain 1  score: 153.0 bits;  conditional E-value: 1.2e-49
                                      DUF934   1 gvllasdedveelaedlerlalialefpkFtDGRgySqarlLRerlgykgelravGdvlrDqlallk 67 
                                                 g++l++de++ee+ ed++++++ial+fp+FtDGR yS arlLR+r+g+kgelra+GdvlrDql++++
  reanno::pseudo13_GW456_L13:PfGW456L13_2842  55 GIWLDADEEAEEIGEDVAQFQVIALNFPAFTDGRNYSNARLLRDRYGFKGELRAIGDVLRDQLFYMH 121
                                                 89***************************************************************** PP

                                      DUF934  68 rcGfdafelredkdleaaekalkefsvaYqaavdepeplf 107
                                                 rcGfdaf++r+dkd+++a++ lk+fsv+Yqaa+dep plf
  reanno::pseudo13_GW456_L13:PfGW456L13_2842 122 RCGFDAFAIRADKDPHEALEGLKDFSVTYQAAADEPLPLF 161
                                                 **************************************97 PP



Or compare reanno::pseudo13_GW456_L13:PfGW456L13_2842 to CDD or PaperBLAST