PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::pseudo5_N2C3_1:AO356_00560 to PF06073 (DUF934)

reanno::pseudo5_N2C3_1:AO356_00560 has 164 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.12
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
    9.6e-50  153.3   0.1    1.2e-49  153.0   0.1    1.1  1  reanno::pseudo5_N2C3_1:AO356_00560  


Domain annotation for each sequence (and alignments):
>> reanno::pseudo5_N2C3_1:AO356_00560  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  153.0   0.1   1.2e-49   1.2e-49       1     107 []      55     161 ..      55     161 .. 0.99

  Alignments for each domain:
  == domain 1  score: 153.0 bits;  conditional E-value: 1.2e-49
                              DUF934   1 gvllasdedveelaedlerlalialefpkFtDGRgySqarlLRerlgykgelravGdvlrDqlallkrcGfdafe 75 
                                         gv+l++de++ee+ +d ++l++ial+fp+FtDGR+yS arlLR+r+g+kgelra+GdvlrDql++++rcGfdaf+
  reanno::pseudo5_N2C3_1:AO356_00560  55 GVWLDADEEAEEIGDDANQLQVIALNFPAFTDGRSYSNARLLRDRYGFKGELRAIGDVLRDQLFYMRRCGFDAFA 129
                                         8************************************************************************** PP

                              DUF934  76 lredkdleaaekalkefsvaYqaavdepeplf 107
                                         lr+dkd+ +a+++lk+fsv+Yqaa+dep plf
  reanno::pseudo5_N2C3_1:AO356_00560 130 LRADKDPYEALESLKDFSVTYQAATDEPLPLF 161
                                         ******************************97 PP



Or compare reanno::pseudo5_N2C3_1:AO356_00560 to CDD or PaperBLAST