PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::pseudo6_N2E2:Pf6N2E2_2074 to PF06073 (DUF934)

reanno::pseudo6_N2E2:Pf6N2E2_2074 has 164 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.12
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                          -----------
    1.9e-49  152.3   0.1    2.4e-49  152.0   0.1    1.1  1  reanno::pseudo6_N2E2:Pf6N2E2_2074  


Domain annotation for each sequence (and alignments):
>> reanno::pseudo6_N2E2:Pf6N2E2_2074  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  152.0   0.1   2.4e-49   2.4e-49       1     107 []      55     161 ..      55     161 .. 0.99

  Alignments for each domain:
  == domain 1  score: 152.0 bits;  conditional E-value: 2.4e-49
                             DUF934   1 gvllasdedveelaedlerlalialefpkFtDGRgySqarlLRerlgykgelravGdvlrDqlallkrcGfdafel 76 
                                        gv+l++de++ee+ ed ++l++ial+fp+FtDGR+yS arlLR+r+g+kgelra+GdvlrDql++++rcGfdaf+l
  reanno::pseudo6_N2E2:Pf6N2E2_2074  55 GVWLDADEEAEEIGEDANQLQVIALNFPAFTDGRSYSNARLLRDRYGFKGELRAIGDVLRDQLFYMRRCGFDAFAL 130
                                        8*************************************************************************** PP

                             DUF934  77 redkdleaaekalkefsvaYqaavdepeplf 107
                                        r+dkd+ +a+++lk+fsv+Yqaa+dep plf
  reanno::pseudo6_N2E2:Pf6N2E2_2074 131 RADKDPFEALESLKDFSVTYQAATDEPLPLF 161
                                        *****************************97 PP



Or compare reanno::pseudo6_N2E2:Pf6N2E2_2074 to CDD or PaperBLAST