VIMSS60245 has 195 amino acids
Query: DUF937 [M=135] Accession: PF06078.15 Description: Bacterial protein of unknown function (DUF937) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-07 15.7 0.0 8.6e-07 15.7 0.0 2.8 3 VIMSS60245 Domain annotation for each sequence (and alignments): >> VIMSS60245 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.7 0.1 0.44 0.44 89 97 .. 6 14 .. 2 22 .. 0.53 2 ? 0.8 9.7 0.034 0.034 57 114 .. 43 97 .. 30 117 .. 0.70 3 ! 15.7 0.0 8.6e-07 8.6e-07 5 57 .. 138 190 .. 134 194 .. 0.88 Alignments for each domain: == domain 1 score: -2.7 bits; conditional E-value: 0.44 DUF937 89 aiLghllGn 97 +iLg+ lG+ VIMSS60245 6 SILGSALGG 14 344444444 PP == domain 2 score: 0.8 bits; conditional E-value: 0.034 DUF937 57 alqsgkhdgsiLdnlgsllggggvaeelleGaaiLghllGnkqeevenalsqasGlds 114 a+q g+ +g++L +lgs+lgg g+ + +++Lg llG+ + ++ +a+ G+++ VIMSS60245 43 AAQGGGDGGGLLGSLGSILGGAGGGAASGGLGGVLGDLLGGAAGGAGQAAP---GVEA 97 6666778889**********9888884433356777777777666555544...3333 PP == domain 3 score: 15.7 bits; conditional E-value: 8.6e-07 DUF937 5 sqlgkqlisqiakqlGeseeqvqsavsaalPallgalkrnaatpegaagLlsa 57 + +g +++q+a ++G s++++++ +s++lP l++ l+ ++ p+g ++ s VIMSS60245 138 RVFGDGQLQQLADSAGVSQGEAAEHLSSLLPELVNKLTPDGQAPQGDLDIGSL 190 56788899**********************************99997776665 PP
Or compare VIMSS60245 to CDD or PaperBLAST