WP_000183451.1 has 196 amino acids
Query: DUF937 [M=135] Accession: PF06078.15 Description: Bacterial protein of unknown function (DUF937) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-07 17.6 17.6 2.8e-07 17.3 0.6 3.1 2 WP_000183451.1 Domain annotation for each sequence (and alignments): >> WP_000183451.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.1 10.1 0.0068 0.0068 66 134 .. 30 92 .. 1 93 [. 0.62 2 ! 17.3 0.6 2.8e-07 2.8e-07 2 50 .. 129 177 .. 128 194 .. 0.84 Alignments for each domain: == domain 1 score: 3.1 bits; conditional E-value: 0.0068 DUF937 66 siLdnlgsllggggvaeelleGaaiLghllGnkqeevenals.qasGldsgsvkklLkllApivlgaLgk 134 +i lgs+lg+ g+++++ ++ Lg +lG+ +v+ + ++G g v++lL ++ p++lg + WP_000183451.1 30 GI---LGSVLGQMGGNTSSG-AQGGLGGVLGSVLGQVTGNNNtPQTG---GGVQSLLIAVVPLILGWVQQ 92 22...566666666665433.56667777777777776554434444...67999**********98766 PP == domain 2 score: 17.3 bits; conditional E-value: 2.8e-07 DUF937 2 lLnsqlgkqlisqiakqlGeseeqvqsavsaalPallgalkrnaatpeg 50 +L+s ++++ i+q+a+q+ + +eqv a++++lP ++ +l+ ++++++ WP_000183451.1 129 QLQSLFNPADIEQVAQQAQAPKEQVYGAIASVLPQVIDSLTPQGESTDH 177 79999***********************************999866543 PP
Or compare WP_000183451.1 to CDD or PaperBLAST