PaperBLAST – Find papers about a protein or its homologs

 

Align B0K010 to PF06110 (DUF953)

B0K010 has 123 amino acids

Query:       DUF953  [M=119]
Accession:   PF06110.11
Description: Eukaryotic protein of unknown function (DUF953)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    3.8e-54  167.6   0.1    4.4e-54  167.5   0.1    1.0  1  B0K010    


Domain annotation for each sequence (and alignments):
>> B0K010  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  167.5   0.1   4.4e-54   4.4e-54       2     119 .]       9     122 ..       8     122 .. 0.98

  Alignments for each domain:
  == domain 1  score: 167.5 bits;  conditional E-value: 4.4e-54
             EEHHHHHHHHHHH..TSSSEEEEEEB--B-TTS-BSSHHHHHHHHHHHHHHHH-SS-EEEEEEE---HHHHT-TTSHHHH..TS---SSSEEEEETSS-EE-H CS
  DUF953   2 akgyeefekslkelekeskivfilFlgekdteGesWCPdCvkaepvieealkeapedvklvrvdvGdrevWkdpanpfRkdpklkltgvPtLlrwkgkkrLee 104
             ++g+eef+k++ke  ++ k++f++F+g+kdteG+sWCPdCv+aep+i+e+lk+++ed+++++++vGd+++Wkdp+n+fR+  klk+t+vPtLl+++++++L e
  B0K010   9 VLGFEEFDKAVKE--HQGKTIFAFFSGSKDTEGKSWCPDCVEAEPIIREGLKHVTEDCVFIYCQVGDKPYWKDPNNDFRQ--KLKITAVPTLLKYGTPQKLVE 107
             79**********9..899**************************************************************..99******************* PP

             HHHH-HHHHHHHHH- CS
  DUF953 105 eqiakksLvellfee 119
             +++ +++Lve++f+e
  B0K010 108 SECRQSNLVEMIFSE 122
             *************86 PP



Or compare B0K010 to CDD or PaperBLAST