PaperBLAST – Find papers about a protein or its homologs

 

Align G7PTE0 to PF06110 (DUF953)

G7PTE0 has 123 amino acids

Query:       DUF953  [M=119]
Accession:   PF06110.11
Description: Eukaryotic protein of unknown function (DUF953)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.1e-50  156.5   0.0    1.2e-50  156.3   0.0    1.0  1  G7PTE0    


Domain annotation for each sequence (and alignments):
>> G7PTE0  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  156.3   0.0   1.2e-50   1.2e-50       2     119 .]       9     122 ..       8     122 .. 0.97

  Alignments for each domain:
  == domain 1  score: 156.3 bits;  conditional E-value: 1.2e-50
             EEHHHHHHHHHHH..TSSSEEEEEEB--B-TTS-BSSHHHHHHHHHHHHHHHH-SS-EEEEEEE---HHHHT-TTSHHHH..TS---SSSEEEEETSS-EE-H CS
  DUF953   2 akgyeefekslkelekeskivfilFlgekdteGesWCPdCvkaepvieealkeapedvklvrvdvGdrevWkdpanpfRkdpklkltgvPtLlrwkgkkrLee 104
             + g+eef+++++e  ++ k++f++F+g+kd  G+sWCPdCv+aepv++e+lk+++e +++++++vG++++Wkdp+n+fRk  +lk+t+vPtLl+++++++L e
  G7PTE0   9 VSGFEEFHRAVEE--HNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRK--NLKVTAVPTLLKYGTPQKLVE 107
             789********99..7789*************************************************************..89******************* PP

             HHHH-HHHHHHHHH- CS
  DUF953 105 eqiakksLvellfee 119
             +++++ +Lve+lf+e
  G7PTE0 108 SECLQANLVEMLFSE 122
             *************86 PP



Or compare G7PTE0 to CDD or PaperBLAST