PaperBLAST – Find papers about a protein or its homologs

 

Align I3L3M7 to PF06110 (DUF953)

I3L3M7 has 80 amino acids

Query:       DUF953  [M=119]
Accession:   PF06110.11
Description: Eukaryotic protein of unknown function (DUF953)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    4.6e-30   89.9   0.1    5.1e-30   89.8   0.1    1.0  1  I3L3M7    


Domain annotation for each sequence (and alignments):
>> I3L3M7  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   89.8   0.1   5.1e-30   5.1e-30       2      73 ..       9      78 ..       8      80 .] 0.95

  Alignments for each domain:
  == domain 1  score: 89.8 bits;  conditional E-value: 5.1e-30
            EEHHHHHHHHHHH..TSSSEEEEEEB--B-TTS-BSSHHHHHHHHHHHHHHHH-SS-EEEEEEE---HHHHT CS
  DUF953  2 akgyeefekslkelekeskivfilFlgekdteGesWCPdCvkaepvieealkeapedvklvrvdvGdrevWk 73
            + g+eef++++++  ++ k++f++F+g+kd  G+sWCPdCv+aepv++e+lk+++e +++++++vG++++ k
  I3L3M7  9 VSGFEEFHRAVEQ--HNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYLK 78
            789********98..7779**************************************************976 PP



Or compare I3L3M7 to CDD or PaperBLAST